PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G152100.1
Common NameB456_010G152100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 278aa    MW: 31249.8 Da    PI: 8.5505
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G152100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.91.4e-3550108462
              zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           lkcprCds+ntkfCyynny+ sqPryfCk+C+r+WtkGG lrnvPvGggr+++++++
  Gorai.010G152100.1  50 PPLKCPRCDSSNTKFCYYNNYNKSQPRYFCKTCKRHWTKGGNLRNVPVGGGRKNKRHQT 108
                         6789***********************************************88888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.7E-3151105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.25152106IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2152105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLSCKQVSS DEVEWIQGQS LLQAPTMERP KASSMKRRHH QENQLQQLEP PLKCPRCDSS  60
NTKFCYYNNY NKSQPRYFCK TCKRHWTKGG NLRNVPVGGG RKNKRHQTSA AASASKTTTT  120
TIKSSTSSAI QPHQLPPADQ KYIPNIKFHS PLQQNSVNCR NSEREIFSTN NGVCLDSTMS  180
QGLQTLFPLP FPFSSSSSYS LETFPSSISA SFQSSSLYNY SGETREDPTG SLTWKEPITS  240
NGIEMANYWN WDDIDALVST DLNIPWDDSE IKPWKDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3937884e-36GQ393788.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0753 SSR marker CGR5843 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451447.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0D2STD60.0A0A0D2STD6_G
STRINGPOPTR_0011s04730.13e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-28TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]